Recombinant Proteins

Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.

7,036 – 7,050 of 114,672 results

7,036

Novus Biologicals™ CCS/SOD4 Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Regulatory Status	RUO
Purification Method	Protein
Purity or Quality Grade	>90%
Conjugate	Unconjugated
Common Name	CCS/SOD4
Molecular Weight (g/mol)	31.2kDa
Gene ID (Entrez)	9973
Formulation	Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.2M NaCl 1mM DTT, 10% glycerol
Immunogen	CCS, 1-274 aa. Sequence: MGSSHHHHHHSSGLVPRGSHMASDSGNQGTLCTLEFAVQMTCQSCVDAVRKSLQGVAGVQDVEVHLEDQMVLVHTTLPSQEVQALLEGTGRQAVLKGMGSGQLQNLGAAVAILGGPGTVQGVVRFLQLTPERCLIEGTIDGLEPGLHGLHVHQYGDLTNNCNSCGNHFNPDGASHGGPQDSDRHRGDLGNVRADADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGRGGHPLSKITGNSGERLACGIIRSAGLFQNPKQICSCDGLTIWEERGRPIAGKGRKESAQPPAHL
Storage Requirements	Store at -80°C. Avoid freeze-thaw cycles.
Concentration	1mg/mL
For Use With (Application)	ELISA,SDS-PAGE
Source	Human

7,037

R&D Systems™ Recombinant Human PRL-3/PTP4A3 Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Pricing & Availability

7,038

Novus Biologicals™ Recombinant Mouse VPS29 His Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability

7,039

Novus Biologicals™ PECR Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability

7,040

R&D Systems™ Recombinant Mouse Lysyl Oxidase Homolog 2 Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Pricing & Availability

7,041

MilliporeSigma™ Phosphodiesterase 7A1, Human, Recombinant Protein, S. frugiperda

Pricing & Availability

7,042

MilliporeSigma™ AMPK (α1/β1/γ1), HisTag™, Human, Recombinant Protein, S. frugiperda

Pricing & Availability

7,043

R&D Systems™ Recombinant Human Klotho His-tag Protein

Mucin Stalk Chimera

Pricing & Availability

7,044

Novus Biologicals™ Recombinant Human EIF4EBP3 His Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Purity or Quality Grade	>85%, by SDS-PAGE
Conjugate	Unconjugated
Gene Alias	eIF4E-binding protein 3, eukaryotic translation initiation factor 4E binding protein 3,4E-BP3eukaryotic initiation factor 4E-binding protein 3, eukaryotic translation initiation factor 4E-binding protein 3,4EBP3
Common Name	EIF4EBP3
Molecular Weight (g/mol)	TMW: 13.3kDa
Gene ID (Entrez)	8637
Formulation	20mM Tris-HCl buffer (pH 8.0) containing 0.15M NaCl, 10% glycerol, 1mM DTT
Storage Requirements	Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles.
Concentration	0.25mg/mL
For Use With (Application)	SDS-PAGE
Recombinant	Recombinant

7,045

Novus Biologicals™ Peflin Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Regulatory Status	RUO
Purification Method	SDS-PAGE
Purity or Quality Grade	>85%
Conjugate	Unconjugated
Common Name	Peflin
Molecular Weight (g/mol)	34.5kDa
Formulation	Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 1mM DTT, 50% glycerol, 0.2M NaCl
Storage Requirements	Store at -80°C. Avoid freeze-thaw cycles.
Concentration	0.25mg/mL
For Use With (Application)	SDS-PAGE

7,046

Novus Biologicals™ Crk Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Regulatory Status	RUO
Purification Method	SDS-PAGE
Purity or Quality Grade	>95%
Conjugate	Unconjugated
Common Name	Crk
Molecular Weight (g/mol)	25.0kDa
Formulation	Liquid. In 20mM Tris-HCl Buffer (pH 8.0) containing 10% Glycerol
Storage Requirements	Store at -80°C. Avoid freeze-thaw cycles.
Concentration	0.5mg/mL
For Use With (Application)	SDS-PAGE,Western Blot

7,047

Novus Biologicals™ PCBD1 Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Regulatory Status	RUO
Purification Method	Protein
Purity or Quality Grade	>95%
Conjugate	Unconjugated
Common Name	PCBD1
Molecular Weight (g/mol)	14.1kDa
Gene ID (Entrez)	5092
Formulation	Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 1mM DTT, 10% glycerol
Immunogen	PCBD1, 1- 104 aa. MGSSHHHHHHSSGLVPRGSHMAGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT
Storage Requirements	Store at -80°C. Avoid freeze-thaw cycles.
Concentration	1mg/mL
For Use With (Application)	ELISA,SDS-PAGE
Source	Human

7,048

Novus Biologicals™ pan-Synuclein Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability

7,049

Novus Biologicals™ NAV3 Recombinant Protein Antigen

Recombinant Protein

Pricing & Availability

7,050

Novus Biologicals™ RBM20 Recombinant Protein Antigen

Recombinant Protein

Pricing & Availability

Prev
1
...
468
469
470
471
...
7,645
Next

Welcome to fishersci.com

Recombinant Proteins

Filtered Search Results

Narrow Results

Novus Biologicals™ CCS/SOD4 Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Mouse VPS29 His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ PECR Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human EIF4EBP3 His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Peflin Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Crk Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ PCBD1 Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ pan-Synuclein Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ NAV3 Recombinant Protein Antigen Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ RBM20 Recombinant Protein Antigen Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ CCS/SOD4 Protein

Novus Biologicals™ Recombinant Mouse VPS29 His Protein

Novus Biologicals™ PECR Protein

Novus Biologicals™ Recombinant Human EIF4EBP3 His Protein

Novus Biologicals™ Peflin Protein

Novus Biologicals™ Crk Protein

Novus Biologicals™ PCBD1 Protein

Novus Biologicals™ pan-Synuclein Protein

Novus Biologicals™ NAV3 Recombinant Protein Antigen

Novus Biologicals™ RBM20 Recombinant Protein Antigen